45,000+ results for (canon, drcker, mp550, canon, drcuker, mp550, canon, drhcker, mp550, canon, dricker, mp550, canon, drjcker, mp550, canon, drkcker, mp550, canon, drocker, mp550, canon, drrucker, mp550, canon, dru+cker, mp550, canon, druc+ker, mp550, canon, druccker, mp550, canon, drucekr, mp550, canon, drucer, mp550, canon, drucger, mp550)
- New ListingCanon RF 70-200mm f/4L IS USM LensOpens in a new window or tabBrand New Unit | Box Light Wear | Free ShippingPre-Owned · Canon RF · f/4 · 70-200mm$1,299.99List price: $3,249.9860% offFree shippingFree returnsTop Rated Plushotdigital-international (22,742) 97.8%
- Kastar Battery LTD2 Charger for Canon BP-820 BP-828 & Canon XA11 Video CameraOpens in a new window or tabBrand New$9.99 to $100.99Free shippingFree returnsTop Rated Pluskastarusa1 (209,227) 99.6%
- New Genuine Canon QY6-0085-010 printhead for Pixma PRO-10, PRO-300Opens in a new window or tabBrand New$368.85Free shippingFree returnsLast oneinkjetprinthead (1,421) 100%
- New ListingCanon PowerShot A550 7.1MP Digital Camera - SilverOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$54.99+$7.95 shippingkellarskollectables (342) 100%
- New ListingCanon PowerShot SD850 IS 8 MP 4x Optical Zoom Compact Digital Camera NO BATTERYOpens in a new window or tabParts Only · Canon PowerShot SD · Compact$39.99+$15.00 shippingsparksman11 (22,964) 99.4%
- New ListingCanon PowerShot SD550 Digital 7.1 MP Zoom Camera + CP1300 Photo Printer kit/caseOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$49.990 bids · Time left6d 6h left (Thu, 05:58 PM)+$9.70 shippingjazzgsonc (67) 100%
- New ListingCanon PowerShot A1100 IS 12.1 MP Digital Camera Green Tested W AA BattsOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$74.99Free shippingFree returnsTop Rated Pluscalifornia545 (14,767) 99.9%
- New ListingCanon PowerShot SD750 7.1MP Digital ELPH Camera + Charger & Extra BatteryOpens in a new window or tabPre-Owned · Canon PowerShot ELPH · Bridge$75.00+$5.80 shippingmittenresale (68) 100%
- New ListingCanon PowerShot G7 X Mark IIOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$500.00+$8.82 shippingdevo_27 (0) 0%
- Canon EOS 550D 18.0MP DSLR Camera (Body Only) - 4428 Shutter CountOpens in a new window or tabPre-Owned · Digital SLR · Canon EOS$151.96+$28.02 shipping estimatefrom United KingdomCustoms services and international tracking providedoliver_and_rae (3,015) 100%
- 💥Canon PowerShot A550 silver 7.1 MP digital compact camera💥WORKING💥Opens in a new window or tabPre-Owned · Canon PowerShot · Compact$64.95+$8.45 shippingnorthernmichigan (81) 100%
- New ListingBlack Canon Camera w/ Straps, Cord & Charger Model #1920705955Opens in a new window or tabPre-Owned · Digital SLR$9.990 bids · Time left6d 23h left (Fri, 11:01 AM)+$6.99 shippingBenefits charitygoodwill_colorado_collectables (5,200) 98.8%
- Canon Powershot A810 16.0 MP 5x Optical Zoom - BlackOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$65.00+$11.60 shipping84 watcherscommanderredearth (95) 100%
- New ListingCanon PowerShot A480 digital cameraOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$65.00+$20.00 shippingfrom Serbiaesales7 (14) 100%
- Zhiyun Crane M3 3-Axis Handheld Gimbal Stabilizer for DSLR Mirrorless CamerasOpens in a new window or tabRefurbished$109.99 to $139.99Free shippingFree returnsSave up to 10% when you buy morevcutech (3,023) 97.7%
- New ListingCanon EF-S 18-135mm 3.5-5.6 IS lens EW-73B for Digital EOS Rebel T8 80D 90D 70DOpens in a new window or tabPre-Owned · Canon EF-S · f/3.5-5.6 · 18-135mm$175.85Free 2-4 day shippingFree returnsTop Rated Pluslukavakeli (39,982) 99.9%
- New ListingCanon PowerShot SD700 IS 6MP Digital CameraOpens in a new window or tabPre-Owned · Canon PowerShot SD · Compact$64.95+$9.00 shippingredrooster97 (1,915) 100%
- Canon EOS R7 Body Mirrorless CameraOpens in a new window or tabFREE & FAST SHIPPING!!!Brand New · Mirrorless Interchangeable Lens$1,144.95List price: $1,431.9920% offFree 1-2 day shippingFree returns54 soldTop Rated Plus6ave (88,624) 99.9%
- New ListingCanon PowerShot SX730 Digital Camera w/40x Zoom & 3 Inch Tilt LCD - BlackOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$375.00Free shippingFree returnsTop Rated Plusconwayair (7,870) 100%
- New Listingcanon eos 500d cameraOpens in a new window or tabPre-Owned · Canon EOS · Mirrorless Interchangeable Lens$180.00+$6.12 shippingtired.s55 (0) 100%
- Canon PowerShot SD550 Digital ELPH 7.1 MP Digital Camera - With ChargerOpens in a new window or tabPre-Owned · Canon PowerShot SD · Compact$129.00+$8.45 shippingFree returnslaab-tennessee (277) 98.5%
- New ListingCANON EOS 5D 12.8 MP DIGITAL CAMERA BODYOpens in a new window or tabPre-Owned · Canon EOS$245.00Free 2-3 day shippingFree returnsTop Rated Plusmidwest_photo (18,551) 100%
- New ListingCANON PowerShot SX50 HS Digital Camera - 12.1MP / 50x / Full HD- TestedOpens in a new window or tabPre-Owned · Canon PowerShot · Bridge$140.00+$10.00 shippingFree returnssuperneat (11) 100%
- Canon EOS R5 Full-Frame Mirrorless Camera , Body OnlyOpens in a new window or tabFREE & FAST SHIPPING!!!Brand New · Canon EOS R · Mirrorless Interchangeable Lens$2,594.95List price: $3,899.0033% offFree 1-2 day shippingFree returns110 soldTop Rated Plus6ave (88,624) 99.9%
- Canon Powershot IXY 650 / ELPH 360 20.2MP Point and Shoot Digital Camera (Black)Opens in a new window or tabBrand New · Canon PowerShot$313.99List price: $409.9923% offFree 3-4 day shippingFree returns65 soldTop Rated Plustedselectronics1 (31,721) 98.7%
- New ListingCanon EOS 550D w/ EF-S IS 18-55mm Stabilize Lens *Exc+ 18.0MP Digital SLR CameraOpens in a new window or tabPre-Owned · Digital SLR · Canon EOS$190.03+$35.04 shipping estimatefrom United KingdomCustoms services and international tracking providedfrancross_123 (1,355) 100%
- Canon T2i 550D w/ 430EX Flash Excellent Condition [NO RESERVE]Opens in a new window or tabPre-Owned$0.731 bid · Time left5d 1h left (Wed, 01:04 PM)+$33.64 shippingfrom Canadayoungereffects (245) 100%
- New ListingCanon PowerShot A590 IS 8MP Gray Digital Camera with 4x Optical Zoom W AAOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$46.99Free shippingFree returnsTop Rated Pluscalifornia545 (14,767) 99.9%
- New ListingCanon Legria HF R706 ++Fantastic condition++BOXED++FREE POSTOpens in a new window or tabPre-Owned$176.09+$35.05 shipping estimatefrom United KingdomCustoms services and international tracking providedashwoodworks (588) 100%
- Pelican Elite Luggage Series carry-on case - Glue Residue - No combo Lock - USEDOpens in a new window or tabPre-Owned$79.99+$20.84 shipping970 soldSave up to 12% when you buy moremainecaseseller (587) 99.4%
- Lot Bulk 125g A-SUB Sublimation Paper 8.5x11 8.5x14 11x17 13x19 110-1100 SheetsOpens in a new window or tabBrand New$19.95 to $319.99Free 2-3 day shippingSave up to 7% when you buy moreewin_sell (30,855) 99.7%
- CIS-Continuous Ink Supply System For Canon PIXMA Pro 100Opens in a new window or tabBrand New$135.96Was: $169.9520% offFree shippingFree returns29 watchersTop Rated Plusinkproducts9 (285) 100%
- New ListingCanon EOS R6 Body *PLEASE READ*Opens in a new window or tabPre-Owned · Canon EOS R · Mirrorless Interchangeable Lens$675.000 bids · Time left2d 23h left (Mon, 10:59 AM)+$35.00 shippingusedcameraplace (731) 98.8%
- New ListingCanon Powershot A710 Is Digital CameraOpens in a new window or tabPre-Owned · Canon PowerShot$74.99+$9.99 shipping411krony (31,138) 99.6%
- New ListingCanon PowerShot Digital ELPH SD630 BRAND NEW!!Opens in a new window or tabBrand New · Canon PowerShot · Compact$199.000 bids · Time left4d 20h left (Wed, 08:09 AM)+$9.95 shippingqgg4w_40 (250) 99.6%
- CANON POWER SHOT S200Opens in a new window or tabPre-Owned · Canon PowerShot · Compact$9.450 bids · Time left5d 7h left (Wed, 06:38 PM)+$6.00 shippingmrcollectorx61 (848) 99.5%
- Canon - PowerShot G7 X Mark II 20.1-Megapixel Digital Video Camera - BlackOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$899.99Free 2-4 day shippingLast one28 soldtib.technologies (1,840) 99.5%
- Canon GPR-55 Drum Unit 0488C003BAOpens in a new window or tabBrand New$399.95+$7.63 shippingchicag_3199 (21) 100%
- Canon EOS Rebel T5 18.0MP DSLR Camera with 18-55mm LensOpens in a new window or tabPre-Owned · Canon EOS Rebel · Digital SLR$224.95+$24.95 shippingFree returns22 watchersTop Rated Plushey_hello_hi (2,570) 99.9%
- Matte White Self-Adhesive Vinyl CANON imagePROGRAF HP DesignJet & Epson RollOpens in a new window or tabBrand New$26.00 to $317.00Free shippingplasticguy1 (1,049) 98.1%
- Canon Powershot A550 Digital Camera with/ /GB SD Card, Case, Cables. TESTEDOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$79.75+$8.20 shippingclarksells2 (114) 100%
- New ListingCanon EOS M10 15-45mm & 22mmOpens in a new window or tabPre-Owned · Canon EOS · Mirrorless Interchangeable Lens$300.00+$10.00 shippingsbox909 (1,023) 100%
- New ListingCanon EOS 20D DSLR Camera Kit W Lens, Bag, & Accessories. Great ConditionOpens in a new window or tabPre-Owned · Canon EOS · Digital SLR$100.00+$19.95 shippingyardsalingwmikeanddave (447) 100%
- New ListingCanon EOS 5D Classic Digital SLR Dslr Camera Mark 1 Original Full Frame 5d 5 DOpens in a new window or tabPre-Owned · Canon EOS · Digital SLR194 product ratings - Canon EOS 5D Classic Digital SLR Dslr Camera Mark 1 Original Full Frame 5d 5 D$149.00+$14.87 shippingiwhanturcamera (1,043) 99%
- Canon Digital IXUS 850 IS Boxed Working 7.1 Mega Pixels Silver TonedOpens in a new window or tabPre-Owned$64.6111 bids · Time left4d 1h left (Tue, 12:55 PM)+$33.74 shipping estimatefrom United KingdomCustoms services and international tracking providedbarnardos_charity (165,880) 99.6%
- CANON OCE PlotWave TDS750, TDS700,PW750 USA , Art. 1070066386 Toner SealedOpens in a new window or tabBrand New$110.00Free shippingLast one1 watchershitch1109 (746) 96.5%
- Canon IXUS 750 - Digital Camera Tested Working w/ Charging CradleOpens in a new window or tabPre-Owned · Compact · Canon IXUS$51.9434 bids · Time left1d left (Sat, 11:31 AM)+$27.59 shipping estimatefrom United KingdomBenefits charityCustoms services and international tracking providedstleonardshospice (3,360) 100%
- New ListingCanon PowerShot SD800 IS 7.1 Mega Pixel 3.8x Optical Zoom Batt Charger Case CardOpens in a new window or tabPre-Owned · Canon PowerShot SD · Compact$49.990 bids · Time left2d 8h left (Sun, 07:40 PM)$84.95Buy It NowFree shippingFree returnsTop Rated Plusdwclausing (940) 100%
- New ListingCanon EOS Digital Camera T1i - UntestedOpens in a new window or tabParts Only · Canon EOS · Digital SLR$57.98+$9.21 shippingj_u_nyabe (545) 100%
- Spaulding Canon GHO Putter RARE.Opens in a new window or tabPre-Owned$85.00+$24.91 shippingdbenny007 (3,718) 100%
- New ListingCanon PowerShot Elph 190IS Digital Compact Camera BlueOpens in a new window or tabPre-Owned · Canon PowerShot ELPH · Compact$100.0014 bids · Time left6d 3h left (Thu, 02:30 PM)+$6.96 shippingjinzo-ningen (4,466) 100%
- New ListingCanon PowerShot A520 4MP Digital Camera Silver Tested Working. GOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$49.00+$12.45 shippingtornadofist (714) 99.4%
- CANNON ZOOM POWER SHOT 20X OPTICAL ZOOM, 12.1 MPOpens in a new window or tabPre-Owned · Canon PowerShot$120.00+$10.00 shippingmistyrain53 (841) 100%
- Canon PowerShot SX610 HS Black 20.2 MP Digital Camera TestedOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$202.50Was: $449.9955% off+$8.60 shippingoutdoorsman987578 (3,375) 98.3%
- Canon FDJ-P01 Servo Focus Demand - USEDOpens in a new window or tabPre-Owned$500.00+$24.46 shipping7 watchersalliedbroadcastgroup (369) 100%
- Canon Powershot IXY 650 / ELPH 360 20.2MP Point and Shoot Digital Camera SilverOpens in a new window or tabBrand New · Canon PowerShot$313.99List price: $499.9937% offFree 3-4 day shippingFree returns73 soldTop Rated Plustedselectronics1 (31,721) 98.7%
- New ListingCanon PowerShot ELPH 130 IS Gray 16.0MP Digital Camera with BoxOpens in a new window or tabPre-Owned · Canon PowerShot ELPH · Compact$199.99+$15.00 shippingthe_drew_crew (1,440) 99.8%
- New ListingCanon EOS M50 Mark II 24.1MP Mirrorless Camera - (EF-M15-45 IS STM KIT) - USEDOpens in a new window or tabPre-Owned · Canon EOS M · Mirrorless Interchangeable Lens$480.00Free shippingpitfall (1,263) 99%
- New ListingCanon T7i With Battery GripOpens in a new window or tabPre-Owned · Canon EOS Digital Rebel · Digital SLR$425.00+$10.42 shippingmpzg8-6 (0) 0%
- New ListingCanon PowerShot A710 IS Digital Camera 7.1 Megapixel 6x Optical ZoomOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$60.00+$9.00 shippingmomoftwo_boys (288) 99.5%
- Canon PowerShot SX540 HS - Digital Camera - BlackOpens in a new window or tabPre-Owned · Canon PowerShot · Bridge$225.00Free shippingFree returnsTop Rated Plusconwayair (7,870) 100%
- Canon PowerShot SX700 HS HD 16.1 MP 30X Zoom Digital Camera, Charger & BatteryOpens in a new window or tabPre-Owned · Canon PowerShot · Compact$199.99+$9.99 shippingaquito04 (1,456) 99.8%
- Canon Powershot A460 - Grey - Fully Working - W/ 1GB CardOpens in a new window or tabPre-Owned$51.9420 bids · Time left9m left (Today 11:35 AM)+$31.32 shipping estimatefrom United KingdomCustoms services and international tracking providedcandevintageandmoderndiscoveries (564) 100%
- New ListingCanon PowerShot SD3500 IS 14.1 Megapixel ELPH TESTED WORKS PERFECT 3.5" Touch SOpens in a new window or tabPre-Owned · Canon PowerShot ELPH · Compact$199.99+$10.10 shippingnanny515 (526) 98.7%
- Canon compact digital camera IXY 650 12x optical zoom IXY650 (BK) (Black)Opens in a new window or tabFREE & FAST SHIPPING!!!Brand New · Canon IXY · Compact$336.37List price: $420.9920% offFree 1-2 day shippingFree returnsTop Rated Plus6ave (88,624) 99.9%
- canon powershot sd550 digital elphOpens in a new window or tabParts Only · Canon PowerShot ELPH · Compact$39.99+$6.33 shippingriver4u2 (128) 100%
- New ListingCanon PowerShot ELPH 100 HS/ 12.1 MP / Gray Digital Camera Battery ChargerOpens in a new window or tabPre-Owned · Canon PowerShot ELPH · Compact$125.00+$6.16 shippingmuggd (728) 99.2%
- Canon EOS C70 4K Cinema Digital Camera - Black (4507C002)Opens in a new window or tabIncludes RF 50 f1.8Pre-Owned · Canon EOS · Digital SLR$3,000.000 bids · Time left1d 23h left (Sun, 10:51 AM)$3,900.00Buy It Now+$60.00 shippingjavinmookie134 (38) 100%
- New ListingCanon PowerShot ELPH 130 IS /IXUS 140 Digital Camera WORKS/ISSUES/SPOT/READ/LOOKOpens in a new window or tabPre-Owned · Canon PowerShot ELPH$84.99+$7.99 shippingdeshideep (6,307) 99.4%
- New ListingCanon PowerShot SX510 HS Digital Camera, SD Card +Extra Battery.Opens in a new window or tabPre-Owned · Canon PowerShot · Compact$75.00+$7.00 shipping3342ann (1,908) 99.2%
- Canon XA75Opens in a new window or tabFREE & FAST SHIPPING!!!Brand New · Canon XA · Camcorder$2,074.95List price: $2,593.9920% offFree 1-2 day shippingFree returns11 watchersTop Rated Plus6ave (88,624) 99.9%
- canon powershot sd550 digital elphOpens in a new window or tabParts Only · Canon PowerShot ELPH · Compact$29.99+$6.23 shippingleyu-163 (2) 100%
- 4- 500ML bottle Compatible Ink For CANON imagePROGRAF TC-20, TC-20 MFP, PFI-050Opens in a new window or tabBrand New$173.68Was: $217.1020% offFree shippingFree returnsTop Rated Plusinkproducts9 (285) 100%
- New ListingCanon EF-S 18-135mm f3.5-5.6 IS STM Lens EFS Free Shipping!Opens in a new window or tabPre-Owned · Canon EF-S · f/3.5-5.6 · 18-135mm$149.99Free shippingbivcoecommerce (1,653) 99.8%
- Items Per Page
![Canon T2i 550D w/ 430EX Flash Excellent Condition [NO RESERVE]](https://i.ebayimg.com/thumbs/images/g/h5QAAOSwSj5mRRUH/s-l140.jpg)
