Disney 100 Cereal
125 results
- New ListingDisney 100 Post Confetti Cake Cereal Limited Edition Collectors Tin NewOpens in a new window or tabBrand New$29.99or Best OfferFree deliveryFree returnsTop Rated Pluswestward_shop (1,084) 98.9%
- Disney 100 Years of Wonder Cereal & Box NEW COLLECTIBLE LIMITED Post CerealOpens in a new window or tabBrand New$3.00or Best Offer+$12.22 deliverySave up to 20% when you buy moreparadisedepot (105) 100%
- 2023 Post Limited Edition Disney 100 Flat Cereal Box FREE U.S.A. SHIPPING!Opens in a new window or tabPre-Owned$6.00Buy It NowFree deliveryFree returnslittlebear-abc (2,891) 100%
- 2023 Post Limited Edition Disney 100 Flat Cereal BoxOpens in a new window or tabPre-Owned$12.95or Best OfferFree deliveryamah_35 (563) 96%
- 2023 Post Limited Edition Disney 100 Flat Cereal BoxOpens in a new window or tabPre-Owned$12.95or Best Offer+$10.00 deliveryotrpeepsjunk (388) 100%
- POST DISNEY 100 YEARS OF WONDER MICKEY MOUSE CLUB LIMITED EDITION 16 OZ. CEREALOpens in a new window or tabBrand New$10.99or Best Offer+$5.99 deliveryLast onecomrus1 (4,771) 100%
- Disney 100 Limited Edition Confetti Cake Cereal By Post 16oz Expires Feb 23 2025Opens in a new window or tabBrand New$4.880 bids · Time left26m left (Today 12:35 PM)$12.88Buy It Now+$6.34 deliveryjari-93 (51) 100%
- 2 Boxes Of Post Disney 100 Years of Wonder Confetti Cake Cereal 16 ozOpens in a new window or tabBrand New$10.000 bids · Time left2d 8h left (Sun, 08:09 PM)or Best Offer+$7.16 deliverycelebratelife77 (419) 100%
- POST DISNEY 100 YEARS OF WONDER Special Edition Cereal, TWO BOXES, UnopenedOpens in a new window or tabBrand New$9.95Buy It Now+$8.47 delivery in 2-4 dayslumen8d (804) 100%
- Limited Edition Post Disney 100 Years Of Wonder Mickey Mouse Club Cereal SealedOpens in a new window or tabBrand New$7.990 bids · Time left18h 32m left (Sat, 06:41 AM)$10.39Buy It Now+$7.16 deliveryduali (2,434) 100%
- Disney Winnie the Pooh 100 Acre Woods 6" Stoneware Pasta Cereal BowlOpens in a new window or tabPre-Owned$12.50or Best Offer+$16.65 deliverybarginhunterinca (2,399) 100%
- POST DISNEY 100 YEARS OF WONDER CONFETTI CAKE FLAVORED CEREAL 16OZ ~Mickey MouseOpens in a new window or tabBrand New$18.50or Best OfferFree deliverymiscellany-marketplace (1,286) 100%
- Disney 100 Years Confetti Cake Cereal Vintage Limited Edition Collectors Tin 🔥Opens in a new window or tabBrand New$38.00or Best Offer+$12.30 deliverycarmenr17 (997) 99.8%
- Disney 100 Years Of Wonder Confetti Cake Cereal NEW In Box And Keepsake TinOpens in a new window or tabBrand New$49.00or Best Offer+$6.34 deliveryglorysgifts (58) 98.3%
- Disney 100 Post Confetti Cake Cereal Limited Edition Collectors Tin IN HANDOpens in a new window or tabBrand New$54.99or Best OfferFree delivery3 watchersrxhsprn1 (277) 80%
- Limited Edition Post Disney 100 Years Of Wonder Cereal, W/Mickey Toy, BirthdayOpens in a new window or tabBrand New$25.00Buy It Now+$8.00 deliverymilisssa (85) 100%
- Disney 100 Years of Wonder Cereal & Box NEW COLLECTIBLE LIMITED Post CerealOpens in a new window or tabBrand New$10.00Buy It Now+$7.00 deliverylorez77 (301) 100%
- New Limited Edition Post Disney 100 Years Of Wonder Mickey Mouse Club Cereal NewOpens in a new window or tabBrand New$4.95or Best Offer+$6.34 deliveryyummer11 (2,651) 100%
- 2002 Kellogg's RAISIN BRAN cereal box ~ Walt Disney World 100 Years Of MagicOpens in a new window or tab$8.06or Best Offer+$8.00 deliveryFree returnsTop Rated Pluskenyatabks (84,647) 99.9%
- Disney 100 Years Confetti Cake Cereal Limited Edition Collectors Tin WalmartOpens in a new window or tabBrand New$45.00or Best Offer+$6.34 deliverytypeogoil1313 (123) 100%
- POST DISNEY 100 YEARS OF WONDER Confetti Cake Cereal, 16oz. - Sealed BoxOpens in a new window or tabBrand New$7.50Buy It Now+$7.15 delivery in 2-4 daysLast one1 watcherslumen8d (804) 100%
- Post Disney 100 Years of Wonder LIMITED EDITION Cereal Brand New Free Shipping!Opens in a new window or tabBrand New$18.950 bids · Time left5d 7h left (Wed, 07:18 PM)$24.79Buy It NowFree deliverychestercopperpot* (790) 100%
- Post Cereal - Disney 100 Years of Wonder Empty Box - 2023Opens in a new window or tabPre-Owned$8.85Buy It Now+$5.25 deliveryFree returnsTop Rated Plusgullbergd (7,366) 100%
- Limited Edition Post Disney 100 Years Of Wonder Fruity Cereal SealedOpens in a new window or tabBrand New$9.990 bids · Time left16h 10m left (Sat, 04:19 AM)$12.99Buy It Now+$7.16 deliveryduali (2,434) 100%
- Post Disney 100 Years of Wonder Mouse Club Cereal (2022) - Empty Box, Sent FlatOpens in a new window or tabPre-Owned$5.99Buy It Now+$8.85 deliveryroger2095 (38,405) 100%
- Set Of 2 Bowls-100 Acre Woods by Disney Winnie the Pooh Stoneware Cereal Bowl 6”Opens in a new window or tabPre-Owned$24.99Buy It Now+$11.95 deliveryLast one8 watchersgersheyw (203) 100%
- MICKEY MOUSE CLUB DISNEY 100 CONFETTI CAKE CEREAL POST LMTD ED FACTORY SEAL 2/24Opens in a new window or tabBrand New$8.99or Best Offer+$11.40 deliverymurphy00 (5,113) 99.6%
- New Limited Edition Post Disney 100 Years Of Wonder Mickey Mouse Club CerealOpens in a new window or tabBrand New$9.00Buy It Now+$11.40 deliverysoulresalestore (323) 100%
- Limited Edition Post Disney 100 Years Of Wonder Cereal, W/Baby Minnie, BirthdayOpens in a new window or tabBrand New$25.00or Best Offer+$13.37 deliverymilisssa (85) 100%
- New Limited Edition Post Disney 100 Years Of Wonder Mickey Mouse Club CerealOpens in a new window or tabBrand New$9.99Buy It Now+$14.85 deliverygilharly01 (379) 100%
- Limited Edition Post Disney 100 Years Of Wonder Mickey Mouse Club Cereal SealedOpens in a new window or tabBrand New$9.99or Best Offer+$6.45 delivery3 watchersSave up to 20% when you buy moreryankeiper22 (212) 90.9%
- DISNEY 100 YEARS CONFETTI CAKE FLAVORED CEREAL 16OZ ~Mickey Mouse club- 2 BoxesOpens in a new window or tabBrand New$20.00or Best Offer+$11.71 deliverytherockingdiva (86) 100%
- New Limited Edition Post Disney 100 Years Of Wonder Mickey Mouse Club CerealOpens in a new window or tabBrand New$8.50Buy It Now+$11.40 deliverysoulresalestore (323) 100%
- Post Disney 100 Years OF Wonder Mickey Mouse Cereal - 14-ounces 5/24/24 BB DateOpens in a new window or tabBrand New$18.99Buy It NowFree deliverybobrush12866 (20,071) 100%
- NEW Limited Edition POST DISNEY 100 YEARS OF WONDER Fruity Flavored CEREAL 14 OZOpens in a new window or tabBrand New$9.99or Best Offer+$6.53 deliverytheghostshop (288) 100%
- 22 DISNEY'S 100 YEARS OF WONDER LIMITED EDITION COLLECTIBLE CEREAL BOX UNOPENEDOpens in a new window or tab$14.99Buy It Now+$11.95 deliverya_rsports (10,897) 100%
- POST DISNEY 100 YEARS OF WONDER Confetti Cake Cereal, 16oz. - Sealed BoxOpens in a new window or tabBrand New$12.00or Best Offer+$6.53 deliverydisneyfandeals_andmore (40) 100%
- Disney 100 Post Limited Edition Collectors Tin - Mickey Mouse Club /No CerealOpens in a new window or tabBrand New$14.99Buy It Now+$10.00 deliverytsit2114 (1,020) 100%
- DISNEY 100 YEARS OF WONDER FRUITY FLAVORED CEREAL 14 OZ POST Mickey Mouse NEWOpens in a new window or tabBrand New$9.99Buy It Now+$9.99 deliverymranguilla (2,692) 99.2%
- 16oz POST DISNEY 100 YEARS OF WONDER MICKEY MOUSE CLUB CONFETTI CAKE CEREAL RAREOpens in a new window or tabBrand New$10.00Buy It Now+$7.00 deliverylorez77 (301) 100%
- Limited edition Mickey Mouse DISNEY 100 Exclusive Tin Confetti Cake Cereal DentsOpens in a new window or tabBrand New$21.99or Best OfferFree deliverylockerroom8702 (1,893) 100%
- Disney 100 Fruity Mickey Breakfast Cereal 14 OZ (NEW AND SEALED IN BOX)Opens in a new window or tabBrand New$14.99Buy It Now+$9.50 deliverycollectiblesmayaddict (1,241) 99.6%
- POST DISNEY 100 YEARS OF WONDER FRUITY FLAVORED 14 OZ. CEREAL BOX FULL SEALEDOpens in a new window or tabBrand New$10.99or Best Offer+$5.99 deliverycomrus1 (4,771) 100%
- Post Disney 100 Years of Wonder LIMITED EDITION Confetti Cake Cereal Brand NewOpens in a new window or tabBrand New$17.950 bids · Time left5d 7h left (Wed, 07:18 PM)$23.49Buy It NowFree deliverychestercopperpot* (790) 100%
- VERY NICE Vintage Disney Winnie The Pooh 100 ACRE WOODS Coupe Cereal Bowl, 6"Opens in a new window or tabPre-Owned$24.00or Best Offer+$8.00 deliverySave up to 20% when you buy moredanjou_antiques (27) 100%
- Limited Edition Post Disney 100 Years Of Wonder Mickey Mouse Club Cereal SealedOpens in a new window or tabBrand New$15.99Buy It NowFree deliverytelephone29 (648) 96.7%
- New 2 POST DISNEY 100 YEARS OF WONDER CEREAL 100th Anniversary Confetti CakeOpens in a new window or tabBrand New$24.99Buy It Now+$13.28 deliverysendit7177 (250) 100%
- Disney 100 Collector Post Cereal Tin - Mickey Mouse Club - LE - No CerealOpens in a new window or tabPre-Owned$20.00or Best Offer+$8.17 deliveryFree returnsTop Rated Plusetsmitch (2,220) 100%
- 16oz POST DISNEY 100 YEARS OF WONDER MICKEY MOUSE CLUB CONFETTI CAKE CEREAL RAREOpens in a new window or tabBrand New$10.00or Best Offer+$6.66 deliverythereviewingnetwork (492) 100%
- Disney 100 Post Confetti Cake Cereal Limited Edition Collectors Tin New SEALEDOpens in a new window or tabBrand New$17.99Was: $29.9940% offBuy It NowFree deliverycarpenoctem95 (4,460) 99.2%
- Limited Edition Mickey Mouse DISNEY 100 Exclusive Tin Confetti Cake Cereal "New"Opens in a new window or tabBrand New$36.22or Best OfferFree deliverycarynok417 (5,248) 98.8%
- Disney 100th Anniversary Limited Edition Cereals Set Of 2 Unopened NEW SOLD OUTOpens in a new window or tabBrand New$22.50Buy It Now+$16.65 deliverybitsy_and_binxys_treasures (687) 97.7%
- PALS VITAMINS T-SHIRT TEE CHARACTER CARTOON CEREALOpens in a new window or tabNew (Other)$14.98 to $18.99Buy It Now+$4.50 deliveryt-shirtexpress (3,585) 100%
- Disney100 Confetti Cake Breakfast Cereal, Limited Edition Collectors Tin, 16 OZOpens in a new window or tabBrand New$25.00Buy It Now+$12.00 deliverysamjhowarth (11) 100%
- Disney Winnie the Pooh 100 Acre Woods 9" Stoneware Salad Cereal Bowl PlateOpens in a new window or tabPre-Owned$10.50or Best Offer+$16.65 deliverybarginhunterinca (2,399) 100%
- NEW POST DISNEY MICKEY MOUSE CLUB CONFETTI CAKE FLAVORED CEREAL 16 OZ 100 YearsOpens in a new window or tabBrand New$14.99Buy It Now+$11.70 deliverysophias-attic1930 (353) 100%
- NEW POST DISNEY 100 YEARS OF WONDER FRUITY FLAVORED CEREAL 14 OZ FREE SHIPPINGOpens in a new window or tabBrand New$20.00or Best Offer+$6.66 deliverythereviewingnetwork (492) 100%
- New Sealed Post Limited Edition Disney 100 Years of Wonder Mickey Mouse CerealOpens in a new window or tabBrand New$19.75Buy It Now+$9.00 deliverypinktree-treasure (912) 98.8%
- Disney 100 Post Confetti Cake Cereal LE Mickey Mouse Collectors Tin Post LimitedOpens in a new window or tabBrand New$9.99or Best Offer+$12.65 deliveryroyrodrimarti (208) 100%
- FAMOUS MONSTERS OF CEREAL T-SHIRT Version 2/ Franken Berry Chocula Boo BerryOpens in a new window or tabNew (Other)$14.98 to $18.99Buy It Now+$4.50 deliveryt-shirtexpress (3,585) 100%
- New 2 POST DISNEY 100 YEARS OF WONDER CEREAL 100th Anniversary Confetti CakeOpens in a new window or tabBrand New$16.99Buy It Now+$6.98 deliverytelephone29 (648) 96.7%
- DISNEY WORLD RESORT KELLOGG'S CEREAL 100 YEARS OF MAGIC 2003 LAPEL PIN TRADINGOpens in a new window or tabPre-Owned$7.49Was: $9.9925% offBuy It Now+$3.55 deliverymarshotel (74,626) 99.9%
- Disney 100 years Post Confetti Cake Cereal Limited Edition Collectors Tin NEWOpens in a new window or tabBrand New$35.00or Best Offer+$9.60 deliveryolos_nah (1,480) 100%
- Post Limited Edition 2023 Disney Pixar 100 Years Of Wonder Cereal New/UnopenedOpens in a new window or tabBrand New$9.97or Best Offer+$10.00 deliverySave up to 25% when you buy moreldsanche (97) 100%
- POST ~ DISNEY 100 YEARS MICKEY MOUSE CLUB CONFETTI CAKE FLAVORED CEREAL 16 Oz.Opens in a new window or tabBrand New$14.75or Best Offer+$14.40 deliveryscrappinpsycho (2,660) 100%
- "Disney 100 Years of Wonder" Post Cereal, Unopened BoxOpens in a new window or tabBrand New$8.99Buy It Now+$11.40 deliverysoulresalestore (323) 100%
- Disney 100 ACRE WOODS Stoneware Winnie the Pooh Motif No Trim SMART CHOICEOpens in a new window or tabPre-Owned$25.87 to $29.87Buy It NowFree deliverymarfern-193 (6,523) 99.8%
- New Limited Edition Post Disney 100 Years Of Wonder Mickey Mouse Club Cereal NewOpens in a new window or tabBrand New$21.95Buy It NowFree deliveryframad-4437 (148) 100%
- IT'S TIME FOR TIMER! CARTOON SATURDAY MORNING CEREAL FANS NOT QUISP DISNEYOpens in a new window or tabBrand New$14.50 to $18.50Buy It Now+$4.00 deliveryt-shirtexpress (3,585) 100%
- "Disney 100 Years of Wonder" Post Cereal, Unopened BoxOpens in a new window or tabBrand New$8.99or Best Offer+$7.01 deliveryzaschum-84 (1,950) 98.2%
- Disney 100 years Post Confetti Cake Cereal Limited Edition Collectors Tin NEWOpens in a new window or tabBrand New$39.99or Best OfferFree deliveryFree returnsTop Rated Plusburgerflips (1,532) 100%
- Disney 100 Years of Wonder Cereal Fruity Flavored (LR)Opens in a new window or tabBrand New$8.00Buy It Now+$18.65 deliverythriftyscoops (1,470) 99.6%
- Disney 100 Confetti Cake Breakfast Cereal Limited TinOpens in a new window or tabBrand New$36.95or Best Offer+$12.95 deliveryLast one2 watcherscatch-some-deals_store (426) 98.4%
- Items Per Page
Related Searches